PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7158_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 112aa    MW: 13160.1 Da    PI: 10.3068
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7158_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.6e-40581177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                +Cq++gC+ dls+ak+yhr+h+vCe hsk+p v+v g+e+rfCqqCsr h++sefDe+krsCr+rL++hn+rrrk+q
  RrC7158_p1  5 RCQIDGCQLDLSSAKDYHRKHRVCENHSKCPLVTVGGMERRFCQQCSRLHAVSEFDEKKRSCRKRLSHHNARRRKPQ 81
                6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-32267IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.53380IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.23E-37481IPR004333Transcription factor, SBP-box
PfamPF031103.1E-31679IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MQVPRCQIDG CQLDLSSAKD YHRKHRVCEN HSKCPLVTVG GMERRFCQQC SRLHAVSEFD  60
EKKRSCRKRL SHHNARRRKP QGVFPLHAQR VYIYLRQIQD SIQDLKKSTD GV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-266791184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16178KKRSCRKRLSHHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0965826e-76KM096582.1 Cardamine hirsuta squamosa promoter-binding-like protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013721621.12e-58PREDICTED: squamosa promoter-binding-like protein 10 isoform X2
RefseqXP_013721620.12e-58PREDICTED: squamosa promoter-binding-like protein 10 isoform X2
RefseqXP_013721619.12e-58PREDICTED: squamosa promoter-binding-like protein 10 isoform X2
RefseqXP_013721617.12e-58PREDICTED: squamosa promoter-binding-like protein 10 isoform X2
RefseqXP_013721616.12e-58PREDICTED: squamosa promoter-binding-like protein 10 isoform X2
RefseqXP_013721615.12e-58PREDICTED: squamosa promoter-binding-like protein 10 isoform X1
SwissprotQ8S9L01e-56SPL10_ARATH; Squamosa promoter-binding-like protein 10
TrEMBLA0A078ETI12e-58A0A078ETI1_BRANA; BnaC07g11390D protein
STRINGBra030041.1-P1e-57(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.47e-58squamosa promoter binding protein-like 10